PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015886455.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Dof
Protein Properties Length: 293aa    MW: 32829.1 Da    PI: 4.7333
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015886455.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.91.9e-374497760
          zf-Dof  7 kcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                    +cprC s+ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++
  XP_015886455.1 44 NCPRCASSNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRR 97
                    8***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-221988IPR003851Zinc finger, Dof-type
PfamPF027015.3E-324397IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6684397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MLSSTTVDHQ LLQQCHHFRP PLMTTNMETN NQSWIKPAIE LAPNCPRCAS SNTKFCYYNN  60
YSLSQPRYFC KGCRRYWTKG GSLRNVPVGG GCRKNRRGNK SSVRLSHRQR PASVSNSNSQ  120
ESGGDPSESS NADSAARQGL DIDMTVVFAK FLNQDAPAAE SSGPRDDSVE SSESRPSCFD  180
MESVRNGYHQ NQSVVVEELV AEDRKVEEVA VGNDVNEFGL DGLLGEQLEQ DVFWSDDSMQ  240
NLPWQLPMGC LQELEGFPSD VYNDQLRFST TNLMNDNWSS LDLYSGFEVF SRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015886455.10.0PREDICTED: dof zinc finger protein DOF1.2-like
SwissprotP683492e-39DOF12_ARATH; Dof zinc finger protein DOF1.2
TrEMBLB9H7P53e-70B9H7P5_POPTR; Uncharacterized protein
STRINGPOPTR_0005s21130.18e-70(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18173394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.15e-33Dof family protein